Dieu Taureau Cie. pharmaceutique, Ltd de Hubei

  Excellence orientée humaine du premier service de qualité la première poursuivent

Maison
Produits
A propos de nous
Visite d'usine
Contrôle de la qualité
contacto
Demande de soumission
Maison ProduitsStéroïdes anabolisant de HGH

DES 1mg d'IGF/stéroïdes anabolisant de la fiole HGH Muscle la protection de peptides d'hormone de croissance

De bonne qualité stéroïde anabolisant de testostérone en ventes
Bonjour, la livraison de paquet et emballé bien, satisfed très avec votre service, coopération de souhait avec vous encore

—— Jason Davis

Je suis apprécie très très avec la qualité du produit, la grande pureté et le bon aspect. souhaitez-vous les bonnes affaires

—— Larry Owen

bien que quelques problèmes se produise sur l'achat, vous me montrez qu'une bonne attitude pour résoudre lui et moi a obtenu le produit, le bon travail

—— Terry Neal

Je suis en ligne une discussion en ligne

DES 1mg d'IGF/stéroïdes anabolisant de la fiole HGH Muscle la protection de peptides d'hormone de croissance

Chine DES 1mg d'IGF/stéroïdes anabolisant de la fiole HGH Muscle la protection de peptides d'hormone de croissance fournisseur

Image Grand :  DES 1mg d'IGF/stéroïdes anabolisant de la fiole HGH Muscle la protection de peptides d'hormone de croissance

Détails sur le produit:

Lieu d'origine: La Chine
Nom de marque: GB
Certification: ISO9001
Numéro de modèle: 1mg/vial 10vials/box

Conditions de paiement et expédition:

Quantité de commande min: 1 boîte
Prix: negotiable
Détails d'emballage: Boîte dure
Délai de livraison: 3 jours
Conditions de paiement: Western Union, Moneygram, T/T
Capacité d'approvisionnement: 10000 boîtes
Contact Now
Description de produit détaillée
Nom du produit: DES d'Igf Spécification: 1mg/vial 10vials/box
Catégorie: Peptide Utilisation: croissance de muscle
Origine: La Chine Apparence: poudre blanche

IGF-1DES 1mg/protection de peptides d'hormone de croissance muscle de fiole

 

1. Ordre : TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
 

2. La masse molaire : 7 372 DA
 

3. Synonymes : IGF-1Des (1-3), Des1-3, DES 1-3, DES (1-3)
 

4. Composé : Thr-Leu-Cys-Gly-aile du nez.
 

5. Pureté : 99,21%
 

Quel est DES IGF-1 ?


1. IGF1-DES est une insuline connexe ou analogue d'insuline ce que le corps fait naturellement. Il effectue le système d'hormone, en grande partie dans le foie, et règle l'énergie et la grosse perte. IGF1-DES également stimule la production de cellules et peut aider avec anti-vieillissement ou des lésions tissulaires.

 

2. DES IGF-1 est plus puissant que l'IGF-1 et ses homologues. Il signifie que quoique la chaîne pour DES IGF-1 ait une période de durée de 20-30 minutes, il peut donner de plus grands avantages courent à long terme. Ce qui signifie que DES IGF-1 devrait être administré dans les muscles vous voulez voir pour transformer et changer des heures supplémentaires utilisant DES IGF-1.

 

3. DES IGF-1 peut stimuler la croissance de tissu pendant la formation par la fixation à l'acide lactique constitué par les muscles. Par conséquent pourquoi DES IGF-1 peut être employé beaucoup plus longtemps que les homologues IGF-1.

 

Combien de DES est-ce qu'IGF-1 je devrais prendre ?

 

Un protocole typique serait :


1. périodes 50-150mcg multiples par jour de DES IGF-1 dans la région localisée que vous voulez connaître la croissance.

L'exemple, si vous voulez administrer 150mcg de DES IGF-1 dans la cuisse, puis vous injectent directement dans le secteur.

 

2. Le protocole typique pour l'injection devrait être : L'administration devrait être donnée avant la formation dans des zones cible spécifiques.

 

Quels sont les effets secondaires de DES IGF-1 ?

 

1. IGF1-DES peut augmenter la taille de la tumeur dans les patients qui ont déjà le cancer. Il n'affecte pas n'importe qui qui n'a pas le cancer, mais peut faire développer des tumeurs après utilisation à long terme.

 

2. Il est facile se produire hypoglycémie avec IGF1-DES dû à l'erreur de calcul du dosage ou au-dessus du dosage de la drogue lui-même. N'employez pas ceci pour des maux de tête, comme il peut être maltraité tout à fait facilement.

 

3. Quelques effets secondaires positifs d'IGF1-DES incluent : graisse de réglementation pour l'usage comme énergie, qui peut avoir comme conséquence la grosse perte, contributions anti-vieillissement par du vieillissement de ralentissement et la réduction de amplification de cellules du processus. Des niveaux bas d'IGF-1 sont liés à l'arrêt du coeur, la fonction inférieure de règlement de cellule du cerveau et de neurone aussi bien que la panne de tissu de muscle.

 

4. Ainsi IGF1-DES peut aider à régler ces domaines problématiques, augmente faire la navette d'éléments nutritifs (aka synthèse de protéine), des plus grandes fonctions régénératrices des tissus nerveux et la capacité pour causer le hyperplasia en cellules musculaires ayant pour résultat un plus plein tissu de muscle.

 

Combien de temps est-ce que je devrais stocker DES IGF-1 ?

 

Pour stocker IGF1-DES vous pouvez le stocker comme liquide ou comme poudre dans un secteur frais de la maison. Si vous la stockez dans le réfrigérateur, vous devrez le chauffer jusqu'à la température ambiante avant l'utilisation

Coordonnées
Hubei God bull Pharmaceutical Co.,Ltd

Personne à contacter: Mr. liu

Téléphone: 86-27-52341258-01

Télécopieur: 86-27-83265180-02

Envoyez votre demande directement à nous (0 / 3000)