Dieu Taureau Cie. pharmaceutique, Ltd de Hubei

  Excellence orientée humaine du premier service de qualité la première poursuivent

Maison
Produits
A propos de nous
Visite d'usine
Contrôle de la qualité
contacto
Demande de soumission
Maison Produits

Stéroïdes anabolisant de HGH

De bonne qualité stéroïde anabolisant de testostérone en ventes
Bonjour, la livraison de paquet et emballé bien, satisfed très avec votre service, coopération de souhait avec vous encore

—— Jason Davis

Je suis apprécie très très avec la qualité du produit, la grande pureté et le bon aspect. souhaitez-vous les bonnes affaires

—— Larry Owen

bien que quelques problèmes se produise sur l'achat, vous me montrez qu'une bonne attitude pour résoudre lui et moi a obtenu le produit, le bon travail

—— Terry Neal

Je suis en ligne une discussion en ligne

Stéroïdes anabolisant de HGH

(93)
Chine 16iu/fiole sans hgh de l'eau employé par le stylo aucune marque signle-barrelled usine

16iu/fiole sans hgh de l'eau employé par le stylo aucune marque signle-barrelled

16iu/fiole sans hgh de l'eau employé par le stylo aucune marque signle-barrelled Nom de produit Stylo de HGH Synonymes Somatoropin, hormone de croissance humaine Aspect Poudre blanche CAS NON. 12629-01-5 Pureté ... Read More
2018-06-26 16:32:47
Chine hgh 36iu/fiole avec le stylo de l'eau aucune hormone de croissance de genotropin de marque usine

hgh 36iu/fiole avec le stylo de l'eau aucune hormone de croissance de genotropin de marque

hgh 36iu/fiole avec de l'eau aucune hormone de croissance de genotropin de marque nous fournisseur d'unité de secteur le plus grand dans des marchandises de hgh de porcelaine et n'offrons des trente-six unités ... Read More
2018-06-26 16:32:23
Chine Le CÆ 031 1mg/fiole ACVR2B Prohormones a lyophilisé le bodybuilding de poudre usine

Le CÆ 031 1mg/fiole ACVR2B Prohormones a lyophilisé le bodybuilding de poudre

Le CÆ 031 1mg/fiole ACVR2B Prohormones a lyophilisé le bodybuilding de poudre 1. Nom de produit : Ace-031 2. Taille d'unité : 1mg/Vial 10 fioles/boîte 3. Aspect : Poudre lyophilisée 4. Contenu : 99% 5. Stockage ... Read More
2018-05-29 10:15:21
Chine Anticorps FST-315 des stéroïdes anabolisant 1mg Follistatin 315 des peptides HGH d'hormone de croissance usine

Anticorps FST-315 des stéroïdes anabolisant 1mg Follistatin 315 des peptides HGH d'hormone de croissance

Anticorps FST-315 des peptides 1mg Follistatin 315 d'hormone de croissance Nom de produit Follistatin 315 L'autre nom Follistatin ordre de N-terminal Gly30 La masse moléculaire prévue kDa 34,7 Poids moléculaire ... Read More
2018-05-29 10:15:21
Chine DES 1mg d'IGF/stéroïdes anabolisant de la fiole HGH Muscle la protection de peptides d'hormone de croissance usine

DES 1mg d'IGF/stéroïdes anabolisant de la fiole HGH Muscle la protection de peptides d'hormone de croissance

IGF-1DES 1mg/protection de peptides d'hormone de croissance muscle de fiole 1. Ordre : TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA 2. La masse molaire : 7 372 DA 3. Synonymes : IGF-1Des ... Read More
2018-05-29 10:15:20
Chine Poudre anti-vieillissement de polypeptide d'Epithalone 10mg/Vial CAS 307297-39-8 usine

Poudre anti-vieillissement de polypeptide d'Epithalone 10mg/Vial CAS 307297-39-8

Poudre anti-vieillissement de polypeptide d'Epithalone 10mg/Vial CAS 307297-39-8 1. Nom de produit : Epitalon 2. CAS : 307297-39-8 3. Mf : C14h22n4o9 4. MW : 390 5. Pureté : 99% 6. Synonymes : Epitalon ; ... Read More
2018-05-29 10:15:20
Chine Peptide d'obésité de stéroïdes anabolisant d'AOD-9604 2mg HGH l'anti a lyophilisé CAS 221231-10-3 usine

Peptide d'obésité de stéroïdes anabolisant d'AOD-9604 2mg HGH l'anti a lyophilisé CAS 221231-10-3

L'anti peptide d'obésité d'AOD-9604 2mg a lyophilisé CAS 221231-10-3 1. Nom de produit : AOD 9604 2. Ordre : Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe 3. Formule moléculaire : C78H123N23O2... Read More
2018-05-29 10:15:20
Chine Fiole GHRF de Tesamorelin 2mg de peptide de perte de poids de stéroïdes anabolisant de TH9507 HGH usine

Fiole GHRF de Tesamorelin 2mg de peptide de perte de poids de stéroïdes anabolisant de TH9507 HGH

Fiole GHRF de Tesamorelin 2mg de peptide de perte de poids du peptide TH9507 Nom de produit Tesamorelin Tesamorelin alias D06655 ; ThGRF Tesamorelin CAS 218949-48-5 Tesamorelin MF C221H366N72O67S Tesamorelin MW ... Read More
2018-05-29 10:15:20
Chine Oxytocine 2mg de peptides/stéroïdes anabolisant du vail HGH CAS 50-56-6 pour la parturition Hasten usine

Oxytocine 2mg de peptides/stéroïdes anabolisant du vail HGH CAS 50-56-6 pour la parturition Hasten

L'oxytocine 2mg/vail CAS 50-56-6 de peptides pour accélèrent la parturition Nom : Oxytocine No. de CAS : 50-56-6 Formule : C43H66N12O12S2 Poids moléculaire : 1007,33 Synonymes : vasopressin 3-Isoleucine-8... Read More
2018-05-29 10:15:20
Chine Croissance lyophilisée injectable de muscle de Triptorelin 2mg/Vial de stéroïdes anabolisant du peptide HGH usine

Croissance lyophilisée injectable de muscle de Triptorelin 2mg/Vial de stéroïdes anabolisant du peptide HGH

Croissance lyophilisée injectable de muscle de Triptorelin 2mg/Vial de peptide 1. Nom de produit : Triptorelin 2. CAS : 57773-63-4 3. MF : C64H82N18O13 4. MW : 1311,45 5. AppearanceWhite ou poudre légèrement ... Read More
2018-05-29 10:15:19
Page 3 of 10|< 1 2 3 4 5 6 7 8 9 10 >|